PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G397900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 214aa    MW: 23410.7 Da    PI: 8.5818
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G397900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.83.3e-42441431100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq++ l+a
  Aqcoe1G397900.1.p  44 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQIQALQA 135
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        el+++++e
  Aqcoe1G397900.1.p 136 ELNAVRAE 143
                        ****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.88843144IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-4244141IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MSRERERFDE IAKKLKTEAD ASDRMGMGRR NLLGPPGTLN TITPCAACKL LRRRCAQECP  60
FSPYFSPHEP QKFASVHKVF GASNVSKMLM EVPESQRADA ANSLVYEANV RLRDPVYGCM  120
GAISALQQQI QALQAELNAV RAEILKYKLR ESTNNLISSS HHMALLSSPT TVSVAQPPPP  180
PPPPVSSTSS MYTQPSSTTD YSCISNENIS YFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007011230.11e-113LOB domain-containing protein 15
SwissprotQ8L5T55e-87LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A061FRT31e-113A0A061FRT3_THECC; LOB domain-containing protein 15
STRINGVIT_13s0067g02380.t011e-110(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.16e-84LOB domain-containing protein 15